PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do001517.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family bZIP
Protein Properties Length: 443aa    MW: 47594.9 Da    PI: 7.1407
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do001517.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_133.87.5e-11287345563
                 CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
      bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                 kr +r   NR +A rs +RK  +i+eLe kv++L++e ++L  +l +l+  +a l +++
  Do001517.1 287 KRVKRILANRQSAARSKERKMRYIQELEHKVQVLQTEATTLSAQLTMLQRDSAGLATQN 345
                 899*********************************************99998887766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.6E-18283347IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.852285348IPR004827Basic-leucine zipper domain
PfamPF001701.6E-9287345IPR004827Basic-leucine zipper domain
SuperFamilySSF579597.74E-12287338No hitNo description
Gene3DG3DSA:1.20.5.1706.5E-12287344No hitNo description
CDDcd147031.11E-22288339No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 443 aa     Download sequence    Send to blast
MDDPGAADHA AARHHLSPQQ LGGQQPPVPR SPTPLDLALA AAAASGYRRL SPSLRPPAHP  60
QARLPSPYGQ IPALGGGGGH HARSLSQPLF FSLDSLPPPP YADLGGAGAA AAHSGVPPSP  120
PSVKREVTIA AEGRSDGAGE DALFDLVNAY MDLDGLDPLN SSEDRHDDRD SRASGTRAGS  180
AAESSENEAE SQSTSADRKD GGKARHCRSL SMDSFMGKLN FAAGDESPKL PLPSPGGGLT  240
RSGSGSLEGG AVALFDMEFA NGEFSESEKK KIMANERLAE IALTDPKRVK RILANRQSAA  300
RSKERKMRYI QELEHKVQVL QTEATTLSAQ LTMLQRDSAG LATQNNELKI RLQAMEQQAQ  360
LRDALNEALT AEVQRLKVAT GEISDGRIPK SLQQQMNSQM LQLQQLQIQQ QQQQQAPQQQ  420
GQRQQQQQQG QRQQQHQQPQ KSA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0696230.0BT069623.1 Zea mays full-length cDNA clone ZM_BFb0192H19 mRNA, complete cds.
GenBankKJ7277390.0KJ727739.1 Zea mays clone pUT5680 bZIP transcription factor (bZIP43) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001147562.10.0uncharacterized protein LOC100281171
TrEMBLB6SSU40.0B6SSU4_MAIZE; DNA binding protein
STRINGGRMZM2G175280_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62473650
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.31e-68bZIP family protein